Plscr4 (NM_178711) Mouse Recombinant Protein
CAT#: TP504754
Purified recombinant protein of Mouse phospholipid scramblase 4 (Plscr4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204754 protein sequence
Red=Cloning site Green=Tags(s) MSGLVPTAPEQPTEEMENQIKSPTAVPDAPPDYNSHFAPGPAGPVASPSAGLPMGYYIPQQPGAIPLYHP TGGTHPIQYQPGKYPVTNQPAPIMWMAGPAPVPNCPPGLEYLAQLDNIHVLQHVEPLELMTRFETNNRYD IKNNIDQMVYIVTEDTDDFTRNAYRNLRPFVLRVTDCLGREIMTMQRPFRCTCCCFCCPCARQELEVQCP PGVTIGFVAEHWNLCRASYSIQNEKKESMMRVRGPCATYGCGSDSVFEINSLDGVSNIGSIIRKWNGFLS TMVNADHFEIRFPLALDVKMKAMIFGSCFLIDFMYFERPPPRRMSR myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 36.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_848826 |
Locus ID | 235527 |
UniProt ID | P58196, Q8BV91 |
Refseq Size | 3259 |
Cytogenetics | 9 E3.3 |
Refseq ORF | 981 |
Synonyms | AV245873 |
Summary | May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |