Mrg2 (BC003762) Mouse Recombinant Protein

CAT#: TP505536

Purified recombinant protein of Mouse myeloid ecotropic viral integration site-related gene 2 (cDNA clone MGC:5914 IMAGE:3593200), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205536 protein sequence
Red=Cloning site Green=Tags(s)

MARRYDELRHYPGITEHMTALASFSEAAPSVPRAPGPYTPHRPPQLQAPGLDSDSLKREKDDIYGHPLFP
LLALVFEKCELATCSPRDGASAGLGSPPGGDVCSSDSFNEDIAAFAKQIRSERPLFSSNPELDNLMVQAI
QVLRFHLLELEKGKMPIDLVIEDRDGSCREDLEDYAASCPSLPDQNTTWIRDHEDSGSVHLGTPGPSSGG
LASQSGDNSSDQGDGLDTSVASPSSAGEDEDLDLERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQ
KKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGASFNPEGQPMAGFTETQPQVTVRTPGSMGM
NLNLEGEWHYL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 39.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 17537
UniProt ID P97368
Refseq Size 1721
Cytogenetics 7 8.76 cM
Refseq ORF 1083
Synonyms Meis3
Summary The protein encoding this gene belongs to the three amino acid loop extension family of homeodomain transcription factors, which play essential roles in many embryonic processes. These proteins are characterized by an atypical homeodomain containing a three amino acid loop extension between helices 1 and 2. Expression of this gene begins during the compaction stage of embryogenesis and continues into the blastocyst stage. This gene is also expressed in pancreatic islet cells and beta-cells and regulates beta-cell survival. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...