Rccd1 (NM_173445) Mouse Recombinant Protein

CAT#: TP505878

Purified recombinant protein of Mouse RCC1 domain containing 1 (Rccd1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205878 protein sequence
Red=Cloning site Green=Tags(s)

MAEKRHGAWFGFGFCGFGQALGSGNSHHSVYSPEPLHASDDICQVSAGWSYTALVTRGGRVELSGSVSGA
ADGCRDVWASEELLVLLRNKGGASTELQAWVPGSALQGEPLWVQNLVSGAKGQGEDEPSRESRMGTLPLL
PCARAYVTPEPPFCQPLAPELRVRQLELGAEHVLLLCTAGQVFSWGAGRHGQLGHGTLEAELEPRLLEAL
QGLRMAKVAAGGWHSVCLSETGDIYIWGWNESGQLALPTRSGTEKKAEREEATELNEDGLKEELAVADAG
APAHFIAIQPFPALLDLPLGSDAVMASCGSRHTAVVTRTGELYTWGWGKYGQLGHKDSTSLDRPCCVEYF
VERQLEVRAVTCGPWNTYVYAMERDKS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 40.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_775621
Locus ID 269955
UniProt ID Q8BTU7
Refseq Size 2340
Cytogenetics 7 D2
Refseq ORF 1131
Synonyms 5830436H09; E430018M08Rik
Summary Plays a role in transcriptional repression of satellite repeats, possibly by regulating H3K36 methylation levels in centromeric regions together with KDM8. Possibly together with KDM8, is involved in proper mitotic spindle organization and chromosome segregation. Plays a role in regulating alpha-tubulin deacetylation and cytoskeletal microtubule stability, thereby promoting cell migration and TGF-beta-induced epithelial to mesenchymal transition (EMT), potentially through the inhibition of KDM8.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...