Myg1 (NM_021713) Mouse Recombinant Protein

CAT#: TP505927

Purified recombinant protein of Mouse melanocyte proliferating gene 1 (Myg1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205927 protein sequence
Red=Cloning site Green=Tags(s)

MGRRFLRGILTLPLRSVLQAQHRMLGSEQDPPAKRLRNNLMAPPRIGTHNGTFHCDEALACALLRLLPEY
ANAEIVRTRDPEKLASCDIVVDVGGEYNPQSHRYDHHQRTFTETMSSLCPGKPWQTKLSSAGLVYLHFGR
KLLAQLLGTSEEDSVVDTIYDKMYENFVEEVDAVDNGISQWAEGEPLYAMTTTLSARVARLNPTWNQPNQ
DTEAGFRRAMDLVQEEFLQRLNFYQHSWLPARALVEEALAQRFKVDSSGEIVELAKGGCPWKEHLYHLES
ELSPKVAITFVIYTDQAGQWRVQCVPKEPHSFQSRLPLPEPWRGLRDKALDQVSGIPGCIFVHASGFIGG
HHTREGALNMARATLAQRPAPVPLANAVVQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 42.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_068359
Locus ID 60315
UniProt ID Q9JK81
Refseq Size 1480
Cytogenetics 15 F3
Refseq ORF 1140
Synonyms 0610023A07Rik; 2810433J21Rik; 5830429P19Rik; AI325965; Gamm1
Summary 3'-5' RNA exonuclease which cleaves in situ on specific transcripts in both nucleus and mitochondrion. Involved in regulating spatially segregated organellar RNA processing, acts as a coordinator of nucleo-mitochondrial crosstalk (PubMed:31081026). In nucleolus, processes pre-ribosomal RNA involved in ribosome assembly and alters cytoplasmic translation. In mitochondrial matrix, processes 3'-termini of the mito-ribosomal and messenger RNAs and controls translation of mitochondrial proteins (PubMed:31081026).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...