Ddx21 (NM_019553) Mouse Recombinant Protein

CAT#: TP510953

Purified recombinant protein of Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 21 (Ddx21), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR210953 protein sequence
Red=Cloning site Green=Tags(s)

MPGKLRSGAKLGSDGAEESMETLPKPSEKKTRKEKTKSKTEEATEGMEEAVSSKAKKTNKKGPSEDDVDP
PKSRKAKKQEEEPQDDTASTSKTSKKKKEPLEKQADSETKEIITEEPSEEEADMPKPKKMKKGKEANGDA
GEKSPKLKNGLSQPSEEEADIPKPKKMKKGKEANGDAGEKSPKLKNGLSQPSEEEVDIPKPKKMKKGKEA
SGDAGEKSPRLKDGLSQPSEPKSNSSDAPGEESSSETEKEIPVEQKEGAFSNFPISEETVKLLKARGVNF
LFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLQGGLQERKRGRAPQVLVLAPTRELANQVSK
DFSDITKKLSVACFYGGTPYGGQIERMRSGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMG
FADQVEEILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKAAITVEHLAIKC
HWTERAAVIGDVIRVYSGHQGRTIIFCETKKDAQELSQNTCIKQDAQSLHGDIPQKQREITLKGFRNGNF
GVLVATNVAARGLDIPEVDLVVQSCPPKDVESYIHRSGRTGRAGRTGVCICFYQNKEEYQLAQVEQKAGI
KFKRIGVPSATEIIKASSKDAIRLLDSVPPTAISHFKQSAEKLIEEKGAVEALAAALAHISGATSVDQRS
LINSQAGFVTMILRCSIEMPNISYAWKELKEQLGESIDAKVKGMVFLKGKLGVCFDVRTEAVTEIQEKWH
DSRHWQLTVATEQPELEGPPDGYRGRMGQRDGSRGAFRGQRGGSRNFRGQGQRGGSRNFRGQRPGGGNRG
QKRSFSKAFGQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 93.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_062426
Locus ID 56200
UniProt ID Q9JIK5
Refseq Size 4763
Cytogenetics 10 32.43 cM
Refseq ORF 2553
Synonyms AI255159; AL022742; D10Ertd645e; D10Wsu42e
Summary RNA helicase that acts as a sensor of the transcriptional status of both RNA polymerase (Pol) I and II: promotes ribosomal RNA (rRNA) processing and transcription from polymerase II (Pol II). Binds various RNAs, such as rRNAs, snoRNAs, 7SK and, at lower extent, mRNAs. In the nucleolus, localizes to rDNA locus, where it directly binds rRNAs and snoRNAs, and promotes rRNA transcription, processing and modification. Required for rRNA 2'-O-methylation, possibly by promoting the recruitment of late-acting snoRNAs SNORD56 and SNORD58 with pre-ribosomal complexes. In the nucleoplasm, binds 7SK RNA and is recruited to the promoters of Pol II-transcribed genes: acts by facilitating the release of P-TEFb from inhibitory 7SK snRNP in a manner that is dependent on its helicase activity, thereby promoting transcription of its target genes. Functions as cofactor for JUN-activated transcription: required for phosphorylation of JUN at 'Ser-77'. Can unwind double-stranded RNA (helicase) and can fold or introduce a secondary structure to a single-stranded RNA (foldase). Involved in rRNA processing. May bind to specific miRNA hairpins (By similarity). Component of a multi-helicase-TICAM1 complex that acts as a cytoplasmic sensor of viral double-stranded RNA (dsRNA) and plays a role in the activation of a cascade of antiviral responses including the induction of proinflammatory cytokines via the adapter molecule TICAM1 (PubMed:21703541).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...