Cpvl (NM_027749) Mouse Recombinant Protein

CAT#: TP525047

Purified recombinant protein of Mouse carboxypeptidase, vitellogenic-like (Cpvl), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR225047 protein sequence
Red=Cloning site Green=Tags(s)

MVRAKWKMVVSLILFMVSPGDGLFHAVYRSILVSQSFKGDAGQPLFLSPYIKNGKIKEGQRKSMVSPFPG
MNDKSYAGYITVNQTYNSNLFFWFFPARMQPEDAPVVLWLQGGPGGSSMFGLFVEHGPYIITSNMTVVAR
DFPWTFTLSMLYIDNPVGTGFSFTDHFQGYATSEDDVAQDLYSALIQFFTLFPEYAKNDFYVTGESYAGK
YVPALAHYIHSLNPVRKFKIRLKGIAIGDAYTDPESIIGGYAAFLYEIGLLDEQQQKYFQKQCSKCVKYI
KEQEWMKAFEILDKLLDGDVTTGSSFFQNVTGCTNYYNILQCTEPKEQSYFAKFLTLPQVRQAIHVGNQN
FSDGAEVEKHLREDTVKSVKPWLSEIMNYYKVLIYNGQLDIIVAAALTERSLMAMDWKGSRAYRRARRKV
WKIFKSDNEVAGYVRRVGKFHQVIVRGGGHILPYDQPMRSFDMINRFIYDRGWEPYNS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 54.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_082025
Locus ID 71287
UniProt ID Q9D3S9
Refseq Size 1708
Cytogenetics 6 B3
Refseq ORF 1434
Synonyms 4933436L16Rik; HVLP
Summary This gene encodes a member of the serine carboxypeptidase family of proteases that cleave amino acids from the C-terminus of a protein substrate. The human ortholog of this gene, where it was first characterized, was found to be upregulated during the maturation of monocytes to macrophages. The encoded protein may be involved in antigen processing, digestion of phagocytosed proteins in the lysosome and lamellipodium formation. Disruption of this gene in mice was found to cause embryonic lethality. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...