Recombinant CXCL13 (C-X-C motif chemokine 13), Human

CAT#: TP728177M

Recombinant CXCL13 (C-X-C motif chemokine 13), Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 4880.00


货期*
2周

规格
    • 100 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR with polyhistidine tag at the N-terminus.
Tag His Tag (N-term)
Predicted MW The protein has a calculated MW of 9.49 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to chemoattract BaF3 cells transfected with human CXCR5. The ED₅₀ for this effect is <20 ng/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID O43927
Synonyms B-cell Attracting Chemokine-1, BLR1 Ligand, BCA-1/BLC
Summary C-X-C motif chemokine 13 (CXCL13) also named B lymphocyte chemoattractant (BLC), which is a chemokine of the intercrine alpha family. CXCL13 is a 7.9kDa protein containing 72 amino acid residues. CXCL13 is a chemotaxis for B lymphocyte. CXCL13 induces the cell proliferation though the AKT signal pathway which plays a key role intestinal cancer model. CXCL13 /CXCR5 axis is highly existed in gut, spleen and lymph nodes.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...