Recombinant CXCL2 (C-X-C motif chemokine 2), Human

CAT#: TP728178M

Recombinant CXCL2 (C-X-C motif chemokine 2), Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 4880.00


货期*
2周

规格
    • 100 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN with polyhistidine tag at the N-terminus.
Tag His Tag (N-term)
Predicted MW The protein has a calculated MW of 8.70 kDa. The protein migrates as 12 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to chemoattract human PBMCs using a concentration range of 10.0 - 100.0 ng/mL. Note: Results may vary from different PBMC donors.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P19875
Synonyms Growth Regulated Protein/Melanoma Growth Stimulatory Activity,GRO-β: MGSAβ,MIP-2α, GRO2
Summary C-X-C motif chemokine 2 (CXCL2) also named Growth-regulated oncogene beta (GROβ), which is a chemokine of the intercrine alpha family. CXCL2 is a 8 kDa protein containing 73 amino acid residues. CXCL2 is expressed in immune cells such as macrophages and monocytes. CXCL2 plays an important role with immune responses and cancer progression. CXCL2 activates the cell signal transduction with casepas1 that affect the cell proliferation, differentiation and migration.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...