Recombinant IL-6 (Interleukin-6), Human

CAT#: TP728271L

Recombinant IL-6 (Interleukin-6), Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 22000.00


货期*
2周

规格
    • 1 mg

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 21.8 kDa. The protein migrates as 22 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce proliferation in TF-1 cells. The ED₅₀ for this effect is <0.5 ng/mL. The specific activity of recombinant human IL-6 is approximately >5 x 10⁸ IU/mg. Measure by its ability to induce proliferation in MCF-7 cells. The ED₅₀ for this effect is <4.4 ng/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P05231
Synonyms IFN-β2, B-Cell Differentiation Factor (BCDF), BSF-2, HPGF, HSF, MGI-2
Summary Interleukin-6 (IL-6) is a pleiotropic, 22-28 kDa cytokine which plays fundamental role in the acute phase response, inflammation, bone metabolism, lymphocyte differentiation and cancer progression. Deregulation of IL-6 production was also found in several diseases, including rheumatoid arthritis, Alzheimer’s disease, autoimmune deficiency disease and different types of cancer.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...