Recombinant TNF beta (Tumor necrosis factor beta), Human

CAT#: TP728290S

Recombinant TNF beta (Tumor necrosis factor beta), Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 700.00


货期*
2周

规格
    • 5 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL with polyhistidine tag at the N-terminus.
Tag His Tag (N-term)
Predicted MW The protein has a calculated MW of 18.65 kDa. The protein migrates as 21 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce cytotoxicity in L929 cells in the presence of actinomycin D. The ED₅₀ for this effect is <3 pg/mL. The specific activity of recombinant human TNF beta is > 3.3x 10⁸ IU/mg.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P01374
Synonyms TNFSF1B, Lymphotoxin-alpha (LT-α),LTA
Summary Human TNF beta (Lymphotoxin-alpha) is a 22 kDa cytokine with 205 amino acid residues. TNF beta belongs to tumor necrosis factor (TNF) superfamily as TNF alpha. Binding to lymphotoxin-β receptor (LtβR), canonical and non-canonical NF-κB signal pathway will be activated. TNF beta is related to apoptosis and inflammatory signals
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...