Recombinant G-CSF (Granulocyte colony-stimulating factor),Mouse

CAT#: TP728321L

Recombinant G-CSF (Granulocyte colony-stimulating factor),Mouse

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 22000.00


货期*
2周

规格
    • 1 mg

Product images

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA with polyhistidine tag at the N- terminus.
Tag His Tag (N-term)
Predicted MW The protein has a calculated MW of 19.76 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce proliferation in NFS-60 cells. The ED₅₀ for this effect is <50 pg/mL. The specific activity of recombinant mouse G-CSF is > 2 x 10⁷ IU/mg.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P09920
Synonyms CSF-3, MGI-1G, GM-CSF beta, pluripoietin
Summary Granulocyte Colony-Stimulating Factor (G-CSF) is a 18.67 kDa protein containing 207 amino acid which secreted by monocytes, macrophages, fibroblasts, and endothelial cells, regulates cell growth, maturation, and development of myeloid cells. G-CSF is a member of the CSF family of glycoproteins, and makes the bone marrow produce more white blood cells so it can reduce the risk of infection after some types of cancer treatment. G-CSF is also an established useful clinical agent for increasing neutrophilic granulocytes levels. Mouse G-CSF shares 73% sequence homology with human G-CSF.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...