Abcc9 (Isoform SUR2A) Mouse Monoclonal Antibody [Clone ID: N319A/14]

CAT#: 75-296

Abcc9 (Isoform SUR2A) mouse monoclonal antibody, clone N319A/14



Need it in bulk or conjugated?
Get a free quote

CNY 6578.00


货期*
3周

规格
    • 100 ul

Product images

Specifications

Product Data
Clone Name N319A/14
Applications IF, IHC, WB
Recommend Dilution Immunoblot (IB)
Immunohistochemistry (IHC)
Immunocytochemistry (ICC)
Reactivity Mouse, Rat
Host Mouse
Clonality Monoclonal
Immunogen Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A (also known as Sulfonylurea receptor 2A, ATP-binding cassette transporter sub-family C member 9A and Abcc9A, accession number P70170).
Rat: 97% identity (41/42 amino acids identical).
Human: 92% identity (39/42 amino acids identical).
100% identity with SUR2C.
<50% identity with SUR2B.
Specificity Does not cross-react with SUR2B
Isotype IgG2a
Formulation State: Purified
Conjugation Unconjugated
Gene Name ATP-binding cassette, sub-family C (CFTR/MRP), member 9
Synonyms Sulfonylurea receptor 2
Note USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
View Research License Agreement
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...