Svop Mouse Monoclonal Antibody [Clone ID: N356/23]

Specifications

Product Data
Clone Name	N356/23
Applications	IF, WB
Recommend Dilution	Immunoblot (IB) Immunocytochemistry (ICC)
Reactivity	Mouse, Rat
Host	Mouse
Clonality	Monoclonal
Immunogen	Fusion protein amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRVGLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK, cytoplasmic N-terminus) of rat SVOP (also known as Synaptic vesicle 2-related protein and SV2-related protein, accession number Q9Z2I7). Mouse: 97% identity (83/85 amino acids identical) Human: 95% identity (81/85 amino acids identical) <20% overall identity with SVOPL/SVOP2 but >80% identity (14/16 amino acids) near C-terminus (TFMVEDAVEAIGFGRF)
Specificity	Does not cross-react with SVOPL/SVOP2
Isotype	IgG1
Formulation	State: Purified
Conjugation	Unconjugated
Gene Name	SV2 related protein
Database Link	Entrez Gene 171442 Rat UniProt ID Q9Z2I7
Synonyms	SV2-related protein
Note	USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows: "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616." Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity. View Research License Agreement
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.