Grp75 (HSPA9) Rabbit Polyclonal Antibody
CAT#: TA329128
Rabbit Polyclonal anti-HSPA9 antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | IHC, IP, WB |
Recommend Dilution | WB, IHC, IP |
Reactivity | Human, Mouse, Rat |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HSPA9 antibody: synthetic peptide directed towards the C terminal of human HSPA9. Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 75 kDa |
Gene Name | heat shock protein family A (Hsp70) member 9 |
Database Link | |
Background | HSPA9 belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. HSPA9 is a heat-shock cognate protein. This protein plays a role in the control of cell proliferation. It may also act as a chaperone.CSHL1 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. This particular family member is expressed in placental villi, although it was originally thought to be a pseudogene. In fact, alternative splicing suggests that the majority of the transcripts would be unable to express a secreted protein.The product encoded by this gene belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. This gene encodes a heat-shock cognate protein. This protein plays a role in the control of cell proliferation. It may also act as a chaperone. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. The protein encoded by this gene is an inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase and contains a Sac domain. The activity of this protein is specific for phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate. Alternatively spliced transcript variants have been observed, but most of them are not thought to be protein-coding. |
Synonyms | CSA; GRP-75; GRP75; HEL-S-124m; HSPA9B; MOT; MOT2; MTHSP75; PBP74 |
Note | Immunogen sequence homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 92%; Pig: 92%; Guinea pig: 92%; Bovine: 85% |
Reference Data | |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | RNA degradation |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |