RGS7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-RGS7 antibody is: synthetic peptide directed towards the N-terminal region of Human RGS7. Synthetic peptide located within the following region: GNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	regulator of G-protein signaling 7
Database Link	NP_002915 Entrez Gene 6000 Human UniProt ID P49802
Background	RGS7 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Activity on G(o)-alpha is specifically enhanced by the RGS6/GNG5 dimer. RGS7 may play a role in synaptic vesicle exocytosis and may play important role in the rapid regulation of neuronal excitability and the cellular responses to short-lived stimulations.
Synonyms	OTTHUMP00000037994; regulator of G-protein signaling 7; regulator of G-protein signaling RGS7; regulator of G-protein signalling 7
Note	Immunogen sequence homology: Human: 100%; Mouse: 100%; Bovine: 100%; Rat: 92%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.