RGS7 Rabbit Polyclonal Antibody
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-RGS7 antibody is: synthetic peptide directed towards the N-terminal region of Human RGS7. Synthetic peptide located within the following region: GNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKI |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 46 kDa |
Gene Name | regulator of G-protein signaling 7 |
Database Link | |
Background | RGS7 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Activity on G(o)-alpha is specifically enhanced by the RGS6/GNG5 dimer. RGS7 may play a role in synaptic vesicle exocytosis and may play important role in the rapid regulation of neuronal excitability and the cellular responses to short-lived stimulations. |
Synonyms | OTTHUMP00000037994; regulator of G-protein signaling 7; regulator of G-protein signaling RGS7; regulator of G-protein signalling 7 |
Note | Immunogen sequence homology: Human: 100%; Mouse: 100%; Bovine: 100%; Rat: 92% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |