Integrin Linked Kinase (ILK) Rabbit Polyclonal Antibody
CNY 4628.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human, Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ILK antibody is: synthetic peptide directed towards the C-terminal region of Human ILK. Synthetic peptide located within the following region: MKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQD |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 49 kDa |
Gene Name | integrin linked kinase |
Database Link | |
Background | Transduction of extracellular matrix signals through integrins influences intracellular and extracellular functions, and appears to require interaction of integrin cytoplasmic domains with cellular proteins. Integrin-linked kinase (ILK), interacts with the cytoplasmic domain of beta-1 integrin. This gene encodes a serine/threonine protein kinase with 4 ankyrin-like repeats, which associates with the cytoplasmic domain of beta integrins and acts as a proximal receptor kinase regulating integrin-mediated signal transduction. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Synonyms | HEL-S-28; ILK-1; ILK-2; P59; p59ILK |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 82% |
Reference Data | |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Endometrial cancer, Focal adhesion, PPAR signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它Integrin Linked Kinase产品