GCP2 (CXCL6) Rabbit Polyclonal Antibody
CAT#: TA329198
Rabbit Polyclonal anti-CXCL6 antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CXCL6 antibody: synthetic peptide directed towards the middle region of human CXCL6. Synthetic peptide located within the following region: GKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKK |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 12 kDa |
Gene Name | C-X-C motif chemokine ligand 6 |
Database Link | |
Background | CXCL6 is chemotactic for neutrophil granulocytes. |
Synonyms | CKA-3; GCP-2; GCP2; SCYB6 |
Note | Immunogen sequence homology: Human: 100%; Rat: 86%; Horse: 86%; Pig: 85%; Rabbit: 85%; Guinea pig: 85%; Bovine: 82% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |