Pit1 (POU1F1) Rabbit Polyclonal Antibody
CAT#: TA329272
Rabbit Polyclonal anti-POU1F1 antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
CNY 3080.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | IHC, WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-POU1F1 antibody: synthetic peptide directed towards the C terminal of human POU1F1. Synthetic peptide located within the following region: QEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 33 kDa |
Gene Name | POU class 1 homeobox 1 |
Database Link | |
Background | PIT1 is a pituitary-specific transcription factor responsible for pituitary development and hormone expression in mammals and is a member of the POU family of transcription factors that regulate mammalian development. The POU family is so named because the first 3 members identified were PIT1 and OCT1 of mammals, and Unc-86 of C. elegans. PIT1 contains 2 protein domains, termed POU-specific and POU-homeo, which are both necessary for high affinity DNA binding on genes encoding growth hormone and prolactin. PIT1 is also important for regulation of the genes encoding prolactin and thyroid-stimulating hormone beta subunit by thyrotropin-releasing hormone and cyclic AMP. |
Synonyms | CPHD1; GHF-1; Pit-1; PIT1; POU1F1a |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |