PMF1 Rabbit Polyclonal Antibody
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PMF1 antibody: synthetic peptide directed towards the middle region of human PMF1. Synthetic peptide located within the following region: AAGSYQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGN |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 23 kDa |
Gene Name | polyamine-modulated factor 1 |
Database Link | |
Background | PMF1 is part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis. It may act as a cotranscription partner of NFE2L2 involved in regulation of polyamine-induced transcription of SSAT. |
Synonyms | Est1p-like protein B (EST1B); OTTHUMP00000016581; polyamine-modulated factor 1 |
Note | Immunogen sequence homology: Goat: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Pig: 92%; Horse: 92%; Guinea pig: 86%; Bovine: 85%; Rabbit: 79%; Dog: 77% |
Reference Data | |
Protein Families | Stem cell - Pluripotency |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |