CMTM2 Rabbit Polyclonal Antibody
CAT#: TA329336
Rabbit Polyclonal anti-CMTM2 antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CMTM2 antibody: synthetic peptide directed towards the N terminal of human CMTM2. Synthetic peptide located within the following region: DKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRRYRWELKDSNKEFWLL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 27 kDa |
Gene Name | CKLF like MARVEL transmembrane domain containing 2 |
Database Link | |
Background | CMTM2 belongs to the chemokine-like factor superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein may play an important role in testicular development. This gene belongs to the chemokine-like factor gene superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development. |
Synonyms | CKLFSF2 |
Note | Immunogen sequence homology: Rat: 100%; Human: 100%; Rabbit: 100%; Horse: 93%; Dog: 87%; Bovine: 87%; Mouse: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |