Zbtb7c Rabbit Polyclonal Antibody
CAT#: TA329367
Rabbit Polyclonal Anti-Zbtb7c Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Zbtb7c antibody is: synthetic peptide directed towards the middle region of Mouse Zbtb7c. Synthetic peptide located within the following region: QDITCPQSPSKTDHLTEKDYSDTPRDFPDSFQPGSPGHLGVIRDFSIESL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 69 kDa |
Gene Name | zinc finger and BTB domain containing 7C |
Database Link | |
Background | Zbtb7c may be a tumor suppressor gene. |
Synonyms | APM-1; APM1; B230208J24Rik; FLJ37907; ZBTB36; ZNF857C |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Mouse: 93%; Goat: 86%; Bovine: 86%; Rabbit: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |