TLR5 Rabbit Polyclonal Antibody

CAT#: TA329399

Rabbit Polyclonal anti-TLR5 antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of toll-like receptor 5 (TLR5)
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Purified recombinant protein of Homo sapiens toll-like receptor 5 (TLR5), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Purified recombinant protein of Homo sapiens toll-like receptor 5 (TLR5), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TLR5 antibody: synthetic peptide directed towards the N terminal of human TLR5. Synthetic peptide located within the following region: QLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFH
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 98 kDa
Gene Name toll like receptor 5
Background TLR5 participates in the innate immune response to microbial agents. It mediates detection of bacterial flagellins. TLR5 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene product is expressed in myelomonocytic cells, and recognizes bacterial flagellin, a principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB and stimulates tumour necrosis factor-alpha production. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms MELIOS; SLE1; SLEB1; TIL3
Note Immunogen sequence homology: Human: 100%; Pig: 83%; Rat: 79%; Goat: 79%; Sheep: 79%; Bovine: 79%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Pathogenic Escherichia coli infection, Toll-like receptor signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...