Foxs1 Rabbit Polyclonal Antibody
CAT#: TA329404
Rabbit Polyclonal anti-Fkhl18 antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Fkhl18 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MQKQPSPESLAPSAEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 35 kDa |
Gene Name | forkhead box S1 |
Database Link | |
Background | Fkhl18 is a transcriptional repressor that suppresses transcription from the FASLG, FOXO3 and FOXO4 promoters.Fkhl18 may have a role in the organization of the testicular vasculature. |
Synonyms | FKHL18; FREAC-10; FREAC10; MGC4544 |
Note | Immunogen sequence homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Rat: 92%; Horse: 85%; Mouse: 85%; Bovine: 85%; Rabbit: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |