GPR87 Rabbit Polyclonal Antibody

Specifications

Product Data
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GPR87 antibody: synthetic peptide directed towards the middle region of human GPR87. Synthetic peptide located within the following region: NQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	G protein-coupled receptor 87
Database Link	NP_076404 Entrez Gene 53836 Human UniProt ID Q9BY21
Background	G protein-coupled receptors play a role in cell communication. They are characterized by an extracellular N terminus, 7 transmembrane regions, and an intracellular C terminus.
Synonyms	FKSG78; GPR95; KPG_002
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%; Rat: 79%
Reference Data
Protein Families	Druggable Genome, GPCR, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.