SYDE1 Rabbit Polyclonal Antibody
CAT#: TA329499
Rabbit Polyclonal anti-SYDE1 antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-SYDE1 antibody: synthetic peptide directed towards the N terminal of human SYDE1. Synthetic peptide located within the following region: PSPPEPEPQAPEGSQAGAEGPSSPEASRSPARGAYLQSLEPSSRRWVLGG |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 80 kDa |
| Gene Name | synapse defective Rho GTPase homolog 1 |
| Database Link | |
| Background | SYDE1 contains 1 Rho-GAP domain. It is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state. |
| Synonyms | 7h3; SYD1 |
| Note | Immunogen sequence homology: Human: 100%; Bovine: 92%; Pig: 86%; Guinea pig: 86%; Rabbit: 85%; Dog: 79%; Rat: 79% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
