Glyt1 (SLC6A9) Rabbit Polyclonal Antibody
CAT#: TA329523
Rabbit Polyclonal anti-SLC6A9 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
CNY 4840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SLC6A9 antibody is: synthetic peptide directed towards the N-terminal region of Human SLC6A9. Synthetic peptide located within the following region: ARPRMAAAHGPVAPSSPEQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSV |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 72 kDa |
Gene Name | solute carrier family 6 member 9 |
Database Link | |
Background | SLC6A9 terminates the action of glycine by its high affinity sodium-dependent reuptake into presynaptic terminals. It may play a role in regulation of glycine levels in NMDA receptor-mediated neurotransmission. |
Synonyms | GLYT1 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |