Glyt1 (SLC6A9) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC6A9 antibody is: synthetic peptide directed towards the N-terminal region of Human SLC6A9. Synthetic peptide located within the following region: ARPRMAAAHGPVAPSSPEQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	72 kDa
Gene Name	solute carrier family 6 member 9
Database Link	NP_964012 Entrez Gene 6536 Human UniProt ID P48067
Background	SLC6A9 terminates the action of glycine by its high affinity sodium-dependent reuptake into presynaptic terminals. It may play a role in regulation of glycine levels in NMDA receptor-mediated neurotransmission.
Synonyms	GLYT1
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.