Rapgef2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse, Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Rapgef2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rapgef2. Synthetic peptide located within the following region: GHTHFDYSGDAASIWASGGHMDQMMFSDHSTKYNRQNQSRESLEQAQSRA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	164 kDa
Gene Name	Rap guanine nucleotide exchange factor (GEF) 2
Database Link	NP_001093094 Entrez Gene 9693 HumanEntrez Gene 76089 Mouse
Background	Rapgef2 is a Guanine nucleotide exchange factor (GEF) for Rap1, Rap1B and Rap2 GTPases.
Synonyms	CNrasGEF; DKFZP586O1422; KIAA0313; NRAPGEP; PDZ-GEF1; PDZGEF1; RA(Ras/Rap1A-associating)-GEF; RA-GEF; Rap-GEP
Note	Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.