Gtpbp10 Rabbit Polyclonal Antibody

Specifications

Product Data
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Gtpbp10 antibody is: synthetic peptide directed towards the N-terminal region of Rat Gtpbp10. Synthetic peptide located within the following region: MVRCGCALLRKYGNFIDNLRIFTKGGSGGMGYPRLGGEGGRGGDVWVVAH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	GTP binding protein 10
Database Link	NP_001094285 Entrez Gene 312054 Rat
Background	The function of this protein remains unknown.
Synonyms	DKFZp686A10121; FLJ38242; MGC104191; ObgH2; UG0751c10
Note	Immunogen sequence homology: Human: 100%; Pig: 93%; Bovine: 93%; Rat: 92%; Horse: 92%; Dog: 86%; Mouse: 86%; Guinea pig: 86%; Rabbit: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.