MKRN3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Mkrn3 antibody is: synthetic peptide directed towards the middle region of Rat Mkrn3. Synthetic peptide located within the following region: ARGGQDSQPRASADRGPKMATHWEPPTQEVAEAPPTASSSSLPLIGSAAE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	makorin ring finger protein 3
Database Link	NP_005655 Entrez Gene 292988 Rat UniProt ID Q13064
Background	The function of this protein remains unknown.
Synonyms	CPPB2; D15S9; RNF63; ZFP127; ZNF127
Note	Immunogen sequence homology: Human: 100%; Mouse: 100%; Rat: 93%; Rabbit: 93%; Pig: 92%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.