Glis1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Glis1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DKRPKEAPGAPGQGRGPVSLGAHMAFRIAVSGGGCGDGNPLDLLPRLPVP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	84 kDa
Gene Name	GLIS family zinc finger 1
Database Link	NP_671754 Entrez Gene 230587 Mouse UniProt ID Q8K1M4
Background	Glis1 acts as both a repressor and activator of transcription. Glis1 binds to the consensus sequence 5'-GACCACCCAC-3'.
Synonyms	FLJ36155; Gli5-like; Glis1-like
Note	Immunogen sequence homology: Mouse: 100%; Rat: 93%; Dog: 91%; Rabbit: 86%; Pig: 79%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.