Helt Rabbit Polyclonal Antibody
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Helt antibody is: synthetic peptide directed towards the C-terminal region of Mouse Helt. Synthetic peptide located within the following region: LPEPDFSYQLHAASPEFPGHSPGEATMFPQGATPGSFPWPPGAARSPALP |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 27 kDa |
Gene Name | helt bHLH transcription factor |
Database Link | |
Background | Helt is a transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3' and is required for the development of GABAergic neurons. |
Synonyms | HCM1228; HES-like; HESL; Heslike; Mgn |
Note | Immunogen sequence homology: Mouse: 100%; Rat: 93%; Horse: 85%; Human: 85%; Bovine: 85%; Pig: 77%; Rabbit: 77%; Guinea pig: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |