DMRTA1 Rabbit Polyclonal Antibody

Specifications

Product Data
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DMRTA1 antibody: synthetic peptide directed towards the N terminal of mouse DMRTA1. Synthetic peptide located within the following region: LRRQQAQEESEARGLHRLLYQGSSGSGAQASGGSGRTESPQVLNNPMAVA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54 kDa
Gene Name	DMRT like family A1
Database Link	NP_071443 Entrez Gene 63951 Human UniProt ID Q5VZB9
Background	Dmrta1 is a DM domain containing transcription factors (DM = dsx and mab-3) and may be involved in sexual development
Synonyms	DMO; DMRT4
Note	Immunogen sequence homology: Mouse: 100%; Rat: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.