nkx6.2 (NKX6-2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-NKX6-2 antibody is: synthetic peptide directed towards the N-terminal region of Human NKX6-2. Synthetic peptide located within the following region: PLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGISDIL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	NK6 homeobox 2
Database Link	NP_796374 Entrez Gene 84504 Human UniProt ID Q9C056
Background	The function of this protein remains unknown.
Synonyms	GTX; NKX6.2; NKX6B
Note	Immunogen sequence homology: Dog: 100%; Rat: 100%; Human: 100%; Pig: 93%; Guinea pig: 93%; Mouse: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.