TEX47 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MGC26647 antibody: synthetic peptide directed towards the N terminal of human MGC26647. Synthetic peptide located within the following region: EEKQRLHLKKFLLDRMFLVAKIQANVERKDVADYYEQMFQSVLKHHLGEA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	chromosome 7 open reading frame 62
Database Link	NP_689919 Entrez Gene 219557 Human UniProt ID Q8TBZ9
Background	The exact function of MGC26647 remains unknown.
Synonyms	MGC26647
Note	Immunogen sequence homology: Human: 100%; Bovine: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.