RNF43 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RNF43 antibody: synthetic peptide directed towards the middle region of human RNF43. Synthetic peptide located within the following region: DFDPLVYCSPKGDPQRVDMQPSVTSRPRSLDSVVPTGETQVSSHVHYHRH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	86 kDa
Gene Name	ring finger protein 43
Database Link	NP_060233 Entrez Gene 54894 Human UniProt ID Q68DV7
Background	RNF43 is a HAP95 (AKAP8L) binding ubiquitin ligase that promotes cell growth and is upregulated in colon cancer.
Synonyms	RNF124; SSPCS; URCC
Note	Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%; Bovine: 86%
Reference Data
Protein Families	Druggable Genome, Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.