Elp4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ELP4 antibody: synthetic peptide directed towards the middle region of mouse ELP4. Synthetic peptide located within the following region: QKSVYAEGFDGANPQKKQKNILRIGIQNLGSPLWGDDICCKENCDNNHRL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	elongator acetyltransferase complex subunit 4
Database Link	NP_076365 Entrez Gene 77766 Mouse UniProt ID Q9ER73
Background	Elongator is a histone acetyltransferase complex that associates with the elongating form of RNA polymerase II. The human homologue of yeast ELP4 is a component of enlogator and show that this gene is ubiquitously expressed in human tissues.
Synonyms	C11orf19; dJ68P15A.1; FLJ20498; hELP4; PAX6NEB; PAXNEB
Note	Immunogen sequence homology: Mouse: 100%; Horse: 91%; Rat: 90%; Dog: 79%; Pig: 79%; Human: 79%; Bovine: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.