Plbd1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Plbd1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ESKKVEIKTVLDKNGDAYGYYNDSIKTTGWGILEIRAGYGSQVLSNEIIM
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	63 kDa
Gene Name	phospholipase B domain containing 1
Database Link	NP_080082 Entrez Gene 66857 Mouse UniProt ID Q8VCI0
Background	1100001H23Rik is a putative phospholipase.
Synonyms	FLJ22662
Note	Immunogen sequence homology: Mouse: 100%; Rat: 92%; Dog: 86%; Pig: 86%; Zebrafish: 82%; Guinea pig: 82%; Horse: 79%; Human: 79%; Rabbit: 79%; Bovine: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.