Taf7l Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Taf7l antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Taf7l. Synthetic peptide located within the following region: QMIYKKAQRQKELLRKVENLTLKRHFQNVLGKLNIMEKEKCEQIYHLQEQ
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	TATA-box binding protein associated factor 7 like
Database Link	NP_083234 Entrez Gene 74469 Mouse UniProt ID Q9D3R9
Background	Taf7l probably functions as a spermatogensis-specific component of the DNA-binding general transcription factor complex TFIID, a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. It may play a role in spermatogenesis.
Synonyms	CT40; FLJ23157; TAF2Q
Note	Immunogen sequence homology: Mouse: 100%; Rat: 91%; Bovine: 82%; Pig: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.