Foxp3 Rabbit Polyclonal Antibody
CAT#: TA329970
Rabbit Polyclonal Anti-Foxp3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Foxp3 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Foxp3. Synthetic peptide located within the following region: LPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPPSQLQLPT |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 47 kDa |
Gene Name | forkhead box P3 |
Database Link | |
Background | Foxp3 is a probable transcription factor. It plays a critical role in the control of immune response. |
Synonyms | AIID; DIETER; FOXP3delta7; IPEX; JM2; MGC141961; MGC141963; PIDX; SCURFIN; XPID |
Note | Immunogen sequence homology: Rat: 100%; Mouse: 100%; Rabbit: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |