Sp7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Sp7 antibody is: synthetic peptide directed towards the N-terminal region of Rat Sp7. Synthetic peptide located within the following region: MLTAACSKFGGSSPLRDSTALGKGGTKKPYTDLSAPKTMGDAYPAPFSST
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	Sp7 transcription factor
Database Link	NP_001032721 Entrez Gene 300260 Rat
Background	Q6IMK1 may act as a transcription factor; mouse homolog is required for bone formation and osteoblast differentiation.
Synonyms	MGC126598; osterix; OSX
Note	Immunogen sequence homology: Mouse: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Human: 93%; Bovine: 93%; Dog: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.