Tbx22 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Tbx22 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SVEALMGRPSKRKAQDPREEMQPELQEEQFVEEGEEILRSPSRDSQQPEK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	T-box 22
Database Link	NP_660259 Entrez Gene 245572 Mouse UniProt ID Q8K402
Background	Tbx22 is a probable transcriptional regulator involved in developmental processes. This is major determinant crucial to palatogenesis.
Synonyms	ABERS; CLPA; CPX; dJ795G23.1; TBXX
Note	Immunogen sequence homology: Mouse: 100%; Rat: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.