GDI1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GDI1 antibody: synthetic peptide directed towards the C terminal of human GDI1. Synthetic peptide located within the following region: VFCSCSYDATTHFETTCNDIKDIYKRMAGTAFDFENMKRKQNDVFGEAEQ
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	GDP dissociation inhibitor 1
Database Link	NP_001484 Entrez Gene 14567 MouseEntrez Gene 2664 Human UniProt ID P31150
Background	GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI1 is expressed primarily in neural and sensory tissues. Mutations in GDI1 have been linked to X-linked nonspecific mental retardation.
Synonyms	1A; GDIL; MRX41; MRX48; OPHN2; RABGD1A; RABGDIA; XAP-4
Note	Immunogen sequence homology: Human: 100%; Guinea pig: 92%; Horse: 92%; Mouse: 92%; Rabbit: 92%; Sheep: 92%; Zebrafish: 92%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.