Munc18 1 (STXBP1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-STXBP1 antibody: synthetic peptide directed towards the middle region of human STXBP1. Synthetic peptide located within the following region: TRSSASFSTTAVSARYGHWHKNKAPGEYRSGPRLIIFILGGVSLNEMRCA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	67 kDa
Gene Name	syntaxin binding protein 1
Database Link	NP_001027392 Entrez Gene 6812 Human UniProt ID P61764
Background	STXBP1 belongs to the STXBP/unc-18/SEC1 family. It may participate in the regulation of synaptic vesicle docking and fusion, possibly through interaction with GTP-binding proteins. The protein is essential for neurotransmission and binds syntaxin, a component of the synaptic vesicle fusion machinery probably in a 1:1 ratio. It can interact with syntaxins 1, 2, and 3 but not syntaxin 4.
Synonyms	MUNC18-1; NSEC1; P67; RBSEC1; UNC18
Note	Immunogen sequence homology: African clawed frog: 100%; Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Zebrafish: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.