PRDM1 Rabbit Polyclonal Antibody

CAT#: TA330023

Rabbit Polyclonal Anti-PRDM1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Transient overexpression lysate of PR domain containing 1, with ZNF domain (PRDM1), transcript variant 1
    • 100 ug

CNY 4840.00


Transient overexpression lysate of PR domain containing 1, with ZNF domain (PRDM1), transcript variant 2
    • 100 ug

CNY 4840.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PRDM1 antibody: synthetic peptide directed towards the middle region of human PRDM1. Synthetic peptide located within the following region: VEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNMGNGLLSSGCSLYES
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 77 kDa
Gene Name PR domain 1
Background PRDM1 is a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induction. Two alternatively spliced transcript variants that encode different isoforms have been reported. This gene encodes a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induction. Two alternatively spliced transcript variants that encode different isoforms have been reported.
Synonyms BLIMP1; PRDI-BF1
Note Immunogen sequence homology: Bovine: 100%; Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Guinea pig: 84%
Reference Data
Protein Families Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...