Oct-1 (POU2F1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-POU2F1 antibody: synthetic peptide directed towards the N terminal of human POU2F1. Synthetic peptide located within the following region: AISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	76 kDa
Gene Name	POU class 2 homeobox 1
Database Link	NP_002688 Entrez Gene 5451 Human UniProt ID P14859
Background	POU2F1 is a member of the POU family that represents the double-stranded DNA binding proteins specifically binding to the block C region.
Synonyms	oct-1B; OCT1; OTF1
Note	Immunogen sequence homology: Chicken: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Bovine: 92%; Dog: 92%; Mouse: 92%; Rat: 92%; Guinea pig: 85%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.