ZNF187 (ZSCAN26) Rabbit Polyclonal Antibody
CAT#: TA330104
Rabbit Polyclonal Anti-ZSCAN26 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF187 antibody: synthetic peptide directed towards the C terminal of human ZNF187. Synthetic peptide located within the following region: KAFRLNSHLAQHVRIHNEEKPYQCSECGEAFRQRSGLFQHQRYHHKDKLA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 36 kDa |
Gene Name | zinc finger and SCAN domain containing 26 |
Database Link | |
Background | ZNF187 may be involved in transcriptional regulation. |
Synonyms | MGC2815; SRE-ZBP; zinc finger protein 187; ZSCAN26 |
Note | Immunogen sequence homology: Human: 100%; Horse: 92%; Pig: 92% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |