ZNF187 (ZSCAN26) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF187 antibody: synthetic peptide directed towards the C terminal of human ZNF187. Synthetic peptide located within the following region: KAFRLNSHLAQHVRIHNEEKPYQCSECGEAFRQRSGLFQHQRYHHKDKLA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	zinc finger and SCAN domain containing 26
Database Link	NP_009082 Entrez Gene 7741 Human UniProt ID Q16670
Background	ZNF187 may be involved in transcriptional regulation.
Synonyms	MGC2815; SRE-ZBP; zinc finger protein 187; ZSCAN26
Note	Immunogen sequence homology: Human: 100%; Horse: 92%; Pig: 92%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.