TFIIE alpha (GTF2E1) Rabbit Polyclonal Antibody

CAT#: TA330119

Rabbit Polyclonal Anti-GTF2E1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of general transcription factor IIE, polypeptide 1, alpha 56kDa (GTF2E1)
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human general transcription factor IIE, polypeptide 1, alpha 56kDa (GTF2E1), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human general transcription factor IIE, polypeptide 1, alpha 56kDa (GTF2E1), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-GTF2E1 antibody: synthetic peptide directed towards the C terminal of human GTF2E1. Synthetic peptide located within the following region: VADDPIVMVAGRPFSYSEVSQRPELVAQMTPEEKEAYIAMGQRMFEDLFE
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 49 kDa
Gene Name general transcription factor IIE subunit 1
Background The general transcription factor TFIIE has an essential role in eukaryotic transcription initiation together with RNA polymerase II and other general factors. Human TFIIE consists of two subunits of relative molecular mass 57,000 (TFIIE-alpha) and 34,000 (TFIIE-beta) and joins the preinitiation complex after RNA polymerase II and TFIIF. TFIIE-alpha is necessary for transcription initiation together with TFIIE-beta, and recombinant TFIIE-alpha can fully replace the natural subunit in an in vitro transcription assay. Its sequence contains several interesting structural motifs (leucine repeat, zinc finger and helix-turn-helix) and sequence similarities to bacterial sigma factors that suggest direct involvement in the regulation of transcription initiation
Synonyms FE; TF2E1; TFIIE-A
Note Immunogen sequence homology: Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Chicken: 92%; African clawed frog: 85%
Reference Data
Protein Families Transcription Factors
Protein Pathways Basal transcription factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...