DBPA (YBX3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CSDA antibody: synthetic peptide directed towards the N terminal of human CSDA. Synthetic peptide located within the following region: AHVAGNPGGDAAPAATGTAAAASLAAAAGSEDAEKKVLATKVLGTVKWFN
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	Y-box binding protein 3
Database Link	NP_003642 Entrez Gene 8531 Human UniProt ID P16989
Background	Human DNA-binding protein (dbpA) is a member of a Y-box binding protein family containing a cold shock domain. The increased expression of Y box binding proteins in somatic cells is associated with cell proliferation and transformation.
Synonyms	CSDA; CSDA1; DBPA; ZONAB
Note	Immunogen sequence homology: Human: 100%; Pig: 100%; Rat: 100%; Bovine: 92%; Dog: 92%; Mouse: 92%; Guinea pig: 84%
Reference Data
Protein Families	Transcription Factors
Protein Pathways	Tight junction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.