ZNF509 (ZBTB49) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF509 antibody: synthetic peptide directed towards the middle region of human ZNF509. Synthetic peptide located within the following region: SAVLRRHKKMHCKAGDESPDVLEELSQAIETSDLEKSQSSDSFSQDTSVT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	85 kDa
Gene Name	zinc finger and BTB domain containing 49
Database Link	NP_660334 Entrez Gene 166793 Human UniProt ID Q6ZSB9
Background	The specific function of ZNF509 is not yet known.
Synonyms	ZNF509
Note	Immunogen sequence homology: Horse: 100%; Human: 100%; Pig: 93%; Bovine: 92%; Mouse: 85%; Dog: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.