Tle5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Aes antibody is: synthetic peptide directed towards the N-terminal region of Mouse Aes. Synthetic peptide located within the following region: QSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	amino-terminal enhancer of split
Database Link	NP_034477 Entrez Gene 14797 Mouse UniProt ID P63002
Background	Aes acts as dominant repressor towards other family members. Aes inhibits NF-kappa-B-regulated gene expressionand may be required for the initiation and maintenance of the differentiated state .
Synonyms	AES-1; AES-2; ESP1; GRG; GRG5; TLE5
Note	Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.